NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0224558_1002707

Scaffold Ga0224558_1002707


Overview

Basic Information
Taxon OID3300023090 Open in IMG/M
Scaffold IDGa0224558_1002707 Open in IMG/M
Source Dataset NamePeat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)15818
Total Scaffold Genes21 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)18 (85.71%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil → Peatland Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location
Location NameSweden: Norrbotten County, Stordalen Mire
CoordinatesLat. (o)68.3532Long. (o)19.0475Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003233Metagenome / Metatranscriptome499Y
F006672Metagenome / Metatranscriptome367Y
F050036Metagenome / Metatranscriptome146Y

Sequences

Protein IDFamilyRBSSequence
Ga0224558_100270713F003233AGGAGMKSRQILIAIVVLGTVWNTAAAQPKKKIKVDAPPPESILAGTSMQSNPVLSELIALKPEMPLGPQDILKSYEIAMSLVADKTSADLSVIVQAQRTNQITREQAEYLLQQSYQIAMMQYQVLSGLHDVLKHDIDEAARQQARQSLKATSSDTALLVPFPGSVPAYR
Ga0224558_100270721F050036GAGMTVTEDRYRSLLGASTALADQPTVKAVLQSLRRVLSSTSRLHGADLYVLSDDGENLSSFEFDRDADAPAIKRGAKLLLI
Ga0224558_10027078F006672AGGAGMSTFDTLPGESNPQIISSIINLVCPQCGGRMSEFQCEGRCRRNWLAEWEWANQATRRPQSRRGYAGRSMRLR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.