| Basic Information | |
|---|---|
| Taxon OID | 3300023070 Open in IMG/M |
| Scaffold ID | Ga0247755_1000007 Open in IMG/M |
| Source Dataset Name | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L096-311B-4 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 179552 |
| Total Scaffold Genes | 186 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 117 (62.90%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Wisconsin | |||||||
| Coordinates | Lat. (o) | 43.3 | Long. (o) | -89.38 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F017067 | Metagenome / Metatranscriptome | 243 | Y |
| F050445 | Metagenome | 145 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0247755_1000007165 | F017067 | GGAGG | MPWWIARKAAPHVWKRVPWAKVWVVSLWLLKKGRDRIEGNLSQREQTEFWNLIKKSKGKPGNLSKRDRTRFKHLVGKAIRG |
| Ga0247755_100000735 | F050445 | GAGG | MSSQVRVGRVWKFAFGIGAIVAPLVAYALAALLVDGHAQESYFDAVSQILPVLLLALAIEQRYFDRAGRERAPESPLQLELAGRRLDDQAMARWYTLAARIYALVVLFLLGFGEWIAVEVLATGESSTADLKNTAGSLAAGFTALIVSALVGTKSERA |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |