NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0224526_1000030

Scaffold Ga0224526_1000030


Overview

Basic Information
Taxon OID3300022872 Open in IMG/M
Scaffold IDGa0224526_1000030 Open in IMG/M
Source Dataset NamePeat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T-25
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)75694
Total Scaffold Genes69 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)53 (76.81%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil → Peatland Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location
Location NameSweden: Norrbotten County, Stordalen Mire
CoordinatesLat. (o)68.3529Long. (o)19.0475Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003713Metagenome / Metatranscriptome472Y
F091175Metagenome / Metatranscriptome107Y

Sequences

Protein IDFamilyRBSSequence
Ga0224526_100003025F003713N/AMILLPAASFAGENFDGQWLTTLTCPAKGNTEGYTWKIPSQVTAGQFRAERGTVDEPGYLLITGPIANNGTAKLSATGIVASRKYARGLLAHGGADYSYDIKATFSGTTGSGVRDEGLGIYGRPCTFDFVKQ
Ga0224526_100003029F091175N/AVDQPADEFLRGGLPFMIISIPISDTVVRAAQEQKMVLEEFVDMLIDKGMEKTTGRPMVSSAIDRIRALHTELPVPRAR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.