NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0222697_1003866

Scaffold Ga0222697_1003866


Overview

Basic Information
Taxon OID3300022868 Open in IMG/M
Scaffold IDGa0222697_1003866 Open in IMG/M
Source Dataset NameSaline water microbial communities from Ace Lake, Antarctica - #1402
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4568
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location NameAntarctica: Ace Lake
CoordinatesLat. (o)-68.4725Long. (o)78.188Alt. (m)Depth (m)14
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F039448Metagenome / Metatranscriptome163Y
F078142Metagenome / Metatranscriptome116Y

Sequences

Protein IDFamilyRBSSequence
Ga0222697_10038661F078142N/AMSFETKAFNSIYASITIARCQIRIGRTVIAKALCAGIGKLRENTDEGQLGSIDANVRLLATDEPDDEIKTGTVIEILQNGQDTKTGWVKARVGGRFPVGGLTRLALEAVNE
Ga0222697_10038663F039448AGAAGMNTSKAIELAMAETLRKYAEMGAAVVVRAWQSLESDGSWNENPDRKFPMIDVRCSPPGHDDNESTLQVECRIMMGTNTDDDKSHAFISNMYEDVQDVCDTLFSQYKTGVFTGEELAYFLARVLAETSSDAFQFGGLTFGEGLAPADDGGINMIGITMIVHYGRSDF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.