NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214917_10000859

Scaffold Ga0214917_10000859


Overview

Basic Information
Taxon OID3300022752 Open in IMG/M
Scaffold IDGa0214917_10000859 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)39541
Total Scaffold Genes79 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)41 (51.90%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier, Atlanta, Georgia, United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)34.2611Long. (o)-83.95Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001881Metagenome / Metatranscriptome622Y
F047649Metagenome / Metatranscriptome149N
F083877Metagenome / Metatranscriptome112Y

Sequences

Protein IDFamilyRBSSequence
Ga0214917_100008591F047649GGAMRYDRTYEHQCDFDEKNKAQKYLTEYRDKYLHLRKEVRNLVKEQNLTITPDFAKLIGLK
Ga0214917_1000085910F001881AGGAMTDRAKEFMNVVWQHRNSGADTEEKLVAAVLQVAAETVKWYNAQNDMIVLDKNDMLQLAEELNQ
Ga0214917_100008592F083877GAGGMTEFYVIMLKRQDGKVYADLHKTNQVIYLTIEDAYEELNSTEHFKENYHIVKLIACLDDLKK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.