NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0228703_1027648

Scaffold Ga0228703_1027648


Overview

Basic Information
Taxon OID3300022747 Open in IMG/M
Scaffold IDGa0228703_1027648 Open in IMG/M
Source Dataset NameFreshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1730
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (42.86%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater → Freshwater Microbial Communities From Mcnutts Creek, Athens, Georgia, United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)33.9263Long. (o)-83.4268Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005727Metagenome / Metatranscriptome392Y
F027748Metagenome / Metatranscriptome193Y
F029368Metagenome / Metatranscriptome188Y

Sequences

Protein IDFamilyRBSSequence
Ga0228703_10276482F029368AGGAMRYNPRTDRALNIDEIAAQCKAAILKADERRYVDQVADRIYDEILTFYRWEDDVLRLNPEPIAA
Ga0228703_10276483F027748N/AMTYAQITAAHLSASQARCAIFDLADDFSWETVAREMISRMSGDEAREFLEDFQSLYAD
Ga0228703_10276486F005727N/AMMRSLTRSRSPEFHRATMLRLTVGALLLWLLWEPIRPIRNVTAQVLYTAGDLIAR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.