Basic Information | |
---|---|
Taxon OID | 3300022548 Open in IMG/M |
Scaffold ID | Ga0212092_1078196 Open in IMG/M |
Source Dataset Name | Cone Pool_combined assembly |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1456 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Microbial Mats → Hot Spring Microbial Mat → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: California | |||||||
Coordinates | Lat. (o) | 37.4127 | Long. (o) | -118.504 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F038537 | Metagenome | 165 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0212092_10781962 | F038537 | GAGG | MIVRVYFWKDLAPLLKRFCREHNIALNRVINLAVQSFIGTSNVEELKLCAKLNQLLREEAELRRVCNAMLRSGSYLPGYVQRVLREPGRSLTHLPDPQRPLKALNPNEERVFRKIAARREQIAREIAEIQEQLLRDVKPFRLKPDLRLSRSRARGKISLKEVKKPNGETA |
⦗Top⦘ |