| Basic Information | |
|---|---|
| Taxon OID | 3300022526 Open in IMG/M |
| Scaffold ID | Ga0224533_1011335 Open in IMG/M |
| Source Dataset Name | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 10-14 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1585 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil → Peatland Microbial Communities From Stordalen Mire, Sweden |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sweden: Norrbotten County, Stordalen Mire | |||||||
| Coordinates | Lat. (o) | 68.3532 | Long. (o) | 19.0469 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003764 | Metagenome | 469 | Y |
| F017951 | Metagenome / Metatranscriptome | 237 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0224533_10113351 | F003764 | GAG | MQIQLDSPYAHDENPAALLAGAEIEAAHLSRSLKIVRLWNQSSALPQSRHDEMIEEEQRLANLYVAIIFEIGSAFGIEQADELKVHIEAACILDDWECPPAEQGFLFPIPNYSATEASPA |
| Ga0224533_10113353 | F017951 | GGAG | MAIAHKFETAGLGIAPFRLVRVEMHWFSIPGIPGSKKPGSSCMFCGHPIAECCFLHDANGKEFHVGNECIKKAGDAGLYDTVKKELRRMKNQAEADAAAATFREGRDILARAEVRALLSTQPHPNSFFAAKGKTMADYYDFLLHNSPRGTVANTVGKLREFAAESIQ |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |