Basic Information | |
---|---|
Taxon OID | 3300022374 Open in IMG/M |
Scaffold ID | Ga0210311_1042143 Open in IMG/M |
Source Dataset Name | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1166 (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 553 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Oregon | |||||||
Coordinates | Lat. (o) | 46.235 | Long. (o) | -123.909 | Alt. (m) | Depth (m) | 5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F088419 | Metagenome / Metatranscriptome | 109 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0210311_10421431 | F088419 | N/A | YGVPLMNNKLICLGALSLFMISGSFAQAGTKPKGQRQAKVRTIDASDIETALKGMTLSAEQNAKVADLVKNFLSGVNGTLTPEQQDQLKTALEKAIAPKSPADNLITSLSAAVTLTPEQELKIKPMVEETLKAMRDKTKGLEANERKQVTEQSMYDLKTALRGVLTTDQQAKLDGWKPSMRGR |
⦗Top⦘ |