NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187833_10024843

Scaffold Ga0187833_10024843


Overview

Basic Information
Taxon OID3300022225 Open in IMG/M
Scaffold IDGa0187833_10024843 Open in IMG/M
Source Dataset NameMarine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_400_PacBio MetaG (Illumina Assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4585
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (53.85%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Microbial And Viral Regulation Of Community Carbon Cycling Across Diverse Low-Oxygen Zones

Source Dataset Sampling Location
Location NamePacific Ocean: Eastern Tropical North Pacific
CoordinatesLat. (o)20.3333Long. (o)-107.0Alt. (m)Depth (m)400
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018449Metagenome / Metatranscriptome235N
F051463Metagenome / Metatranscriptome144N
F080512Metagenome115N

Sequences

Protein IDFamilyRBSSequence
Ga0187833_100248431F018449AGGAMLTLDRIGLVRVFKQMVLGYSLNLSPNTLAPRKESKMNKLLIILLSFLLVSCASYKPVADLKASTNANNYQEDRQHCRLLIKEEFNAFYAAWYDRELLSRCLNGRGHNVLNTYTIGN
Ga0187833_100248432F051463N/AMNIVSAEEKLRDGLLQELISQARIELIKLLQNDKESGKSWVAIPKGSSNRYLKVATLKRVLRDKFNHTLILESKIKHDDMNRVIIEATLSHKNGGFLSSGLAERWKDSQSSNVQKQRAIECCQTAAWGRCIKSLLAVGYDISTADEIDRSIISDINKEIDKEVQ
Ga0187833_100248438F080512GGAGGMIKNCYTIQKHHQQLNYGEQFLKEPYLIAVVFLRTVNLTTAWQLGTELFTKLKAGSMIITTMNKCAVSLIWNLIMSLNLKKMPRSISKIRQKKGQHYYQLCSIGCSVGIMVKAKYVSMECCRCLKTQNKLYWFSSGGHSEWDDHFYCKECFRRLFKMLPEKVKLTFSGYKGKDKNVS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.