Basic Information | |
---|---|
Taxon OID | 3300021977 Open in IMG/M |
Scaffold ID | Ga0232639_1274051 Open in IMG/M |
Source Dataset Name | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Hafa_FS925 _150kmer |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Marine Biological Laboratory |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 646 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Marine Group I → Marine Group I thaumarchaeote | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids → Characterization Of Microbial Community From Mariana Back Arc |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Hafa Adai vent field, Mariana back arc basin | |||||||
Coordinates | Lat. (o) | 16.96173128 | Long. (o) | 144.86920936 | Alt. (m) | Depth (m) | 3278 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F006552 | Metagenome | 370 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0232639_12740512 | F006552 | N/A | KYLDLGKKVLIVXENAINQYPTVWEATPKVEIPLLISPVLKIKSSRINPVANIPKPIPIAKKAIDILNNVGLPVFLNPTYEIVPTTTPTKSPTKFRIISRKNSNYADSVTILNKVSEQVF |
⦗Top⦘ |