NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0222712_10176895

Scaffold Ga0222712_10176895


Overview

Basic Information
Taxon OID3300021963 Open in IMG/M
Scaffold IDGa0222712_10176895 Open in IMG/M
Source Dataset NameEstuarine water microbial communities from San Francisco Bay, California, United States - C33_657D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1417
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (100.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)38.1516Long. (o)-121.6883Alt. (m)Depth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000447Metagenome / Metatranscriptome1128Y
F005531Metagenome / Metatranscriptome397Y
F011386Metagenome / Metatranscriptome291Y
F038479Metagenome / Metatranscriptome166Y

Sequences

Protein IDFamilyRBSSequence
Ga0222712_101768951F011386AGAAGMKVTLTSMQGNTRNIDLMTKQEVLDFIDLFKSTLHRSQRVKVTCDLLGIDGYLQGTR
Ga0222712_101768953F005531AGAAGMTITYTLWQGSQLLAVNQKASKPEEILAVIEELNKLGKGFTYNIREVDTK
Ga0222712_101768954F038479AGGTGGMTTLTLNDKIAKAAQMVADGELVSFRGASADTYNKVMALANRIKQDREFPQCPCGECD
Ga0222712_101768956F000447GGAGMGYIEIFRLDEQGAGWVDLSEATPDELLNLEIGLLNEG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.