Basic Information | |
---|---|
Taxon OID | 3300021603 Open in IMG/M |
Scaffold ID | Ga0226659_10140586 Open in IMG/M |
Source Dataset Name | Granular sludge microbial community from anaerobic digester, University of Toronto, Ontario, Canada - UASBVu03_granules spades |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Toronto |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1187 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Granular Sludge → Metagenomes From Anaerobic Digester Of Solid Waste |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | University of Toronto, Toronto, Ontario, Canada | |||||||
Coordinates | Lat. (o) | 43.6629 | Long. (o) | -79.3957 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F051554 | Metagenome | 144 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0226659_101405863 | F051554 | AGGA | MTFQLKFYVPFKAAEGINADLALKEGILPIEGTAIDTSVNANKWQVPPEDLDFFTASLKGAQLRIDHAESVLSIVGKVPEAIRSGNQVFFQAEVGEPSIIPKILRGYVNHVSVQVDSDDTECSVCGKQTRIEGILTHLCSGAWEIVHKPRVRELSIVASPAYKNTAFHPVGFAAAM |
⦗Top⦘ |