NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0226659_10034217

Scaffold Ga0226659_10034217


Overview

Basic Information
Taxon OID3300021603 Open in IMG/M
Scaffold IDGa0226659_10034217 Open in IMG/M
Source Dataset NameGranular sludge microbial community from anaerobic digester, University of Toronto, Ontario, Canada - UASBVu03_granules spades
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Toronto
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3300
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (87.50%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Granular Sludge → Metagenomes From Anaerobic Digester Of Solid Waste

Source Dataset Sampling Location
Location NameUniversity of Toronto, Toronto, Ontario, Canada
CoordinatesLat. (o)43.6629Long. (o)-79.3957Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015605Metagenome / Metatranscriptome253N
F036594Metagenome / Metatranscriptome169N

Sequences

Protein IDFamilyRBSSequence
Ga0226659_100342171F036594N/AQLSVPKNFYGSNFYSVGEQGTQAVLNKVEGELKEKGVHTSLIEAEMSRVDTFKNIEPEEPFSSYYSLFSLLKARKAIQRGYGTTFLLSNSQQEFCVYDKLEEMRERNIETRGLPPTMRFEHRLLNKQKIQNVYGFGRVGELFKGGYEVVKEKQVESWKASLFNFTTEEFVLLGSKQLEQEMRRFKEKSPSGWFSKFLKAYGAYYLASHAGKEVIIEALQNSEAERTMIWRAVQIFEEAERELLVLKQEEGSKKTLGALYEELRRKVCLN
Ga0226659_100342178F015605AGGAGMIDTLKLMLNEYEITDDSEIRVQPASYELGTGSKVEYPLFQTPSHGSHYGSKAYLNAENWNLTLKPLPGGRATGAFLQLSVPKNYYGSNFYSVGEQGTQAVLSKVEGELKEKGVHTPLIEADMSRVDTFKNIEPEEPFSSYYTLFSLLKARRAIQRGYGTTFLLSNSQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.