NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0126371_10080171

Scaffold Ga0126371_10080171


Overview

Basic Information
Taxon OID3300021560 Open in IMG/M
Scaffold IDGa0126371_10080171 Open in IMG/M
Source Dataset NameTropical forest soil microbial communities from Panama - MetaG Plot_4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3200
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Panama Analyzed To Predict Greenhouse Gas Emissions

Source Dataset Sampling Location
Location NamePanama
CoordinatesLat. (o)9.1086Long. (o)-79.8436Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001318Metagenome / Metatranscriptome724Y
F001671Metagenome / Metatranscriptome654Y

Sequences

Protein IDFamilyRBSSequence
Ga0126371_100801713F001318GGAGGMKKWAWILAVPLLVSIAGAQVLPSMKVQNDSASGTWHEAPAGERFFLPKDTFWGWAQFDLAPPHNEIDPNLCAGNAGQYGGVNAPCSMFARYMLSGILEVRPFGTGPLRRFMVFGAPTFLFGKTVPKTLYTWSWDAIGIEHSWGAGIYIDKGFEFRLTQHFLFDRLGARDRNLGPADLGNNGPWGRYLSLGVRKTFGTRRW
Ga0126371_100801714F001671AGGAMPQEISVSYQAIKSKVYRLIDALVVGEKSEAEVQESVRRWWSLIHPADRPIAQKYLVMVLGRSNSALDAMGSELLSVSGI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.