| Basic Information | |
|---|---|
| Taxon OID | 3300021550 Open in IMG/M |
| Scaffold ID | Ga0224715_1050488 Open in IMG/M |
| Source Dataset Name | Marine sponge Stylissa sp. microbiome, Papua New Guinea CO2seep, Upa-Upasina 'control', st9ic 200bp no Eukaryotes last |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of New South Wales |
| Sequencing Status | Finished |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 846 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Stylissa Sp. (Marine Sponge) → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Upa-Upasina 'control' site, Papua New Guinea | |||||||
| Coordinates | Lat. (o) | -9.828217 | Long. (o) | 150.820517 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F012584 | Metagenome | 279 | Y |
| F037769 | Metagenome | 167 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0224715_10504882 | F037769 | GAGG | MNYIQTQTDKEDEKLLRRLLSEKMPEKDADKIISHVFSNLIKWTYEDAVLHLTQVFNFTEEESNQLIKEYDILSSTTKEVIMNPPPNFNATAPNDVKDYSANLWQARKCLSDAKKLINATALTPRDYENDEDFHEALLHRLHIAEHFISINKYIDEHLDFAKAHIPPQAP |
| Ga0224715_10504883 | F012584 | N/A | MKLKPYLPENTFILSEDSLPKEHDTDRFGKIMVFRKDVGWSVIPLTDAVQFLAMKHTHWTFT |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |