NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210402_10000687

Scaffold Ga0210402_10000687


Overview

Basic Information
Taxon OID3300021478 Open in IMG/M
Scaffold IDGa0210402_10000687 Open in IMG/M
Source Dataset NameForest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)37212
Total Scaffold Genes41 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)36 (87.80%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.481016Long. (o)-72.178343Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004293Metagenome / Metatranscriptome445Y
F007051Metagenome / Metatranscriptome359Y
F009643Metagenome / Metatranscriptome315Y
F012393Metagenome / Metatranscriptome281Y

Sequences

Protein IDFamilyRBSSequence
Ga0210402_1000068719F004293N/AMERLKNTLLVLCLFVVLLVIFSSYFRANEVGTFFGALAGTPLLVHIFNRMAPSWSKPEPERTTALVAHAEPRPRPPEQVVVFRMEGPNGRA
Ga0210402_100006873F012393N/AMVEDRQVTTEDVLEAARRRRRLCDDVEVDDPVTADAVLAAFEARMEQRLDLGVVNRALNVFLEPRNPFEPERTRKPKMETVIFGMLLGLVVAAFLFFNLAAPRLQVHP
Ga0210402_1000068738F007051AGGAGMQQKTITVVIDQNGDSSVDLEGFAGQGCDKVLKDLQGDDHAKVQRKKAAFYSTAVDSRDQHLKSGQ
Ga0210402_100006874F009643AGGMSKPWRARLDGALRGGEIAGLYFTTALLIVVEFCLVCWLNRIPIPDVPNAGSGFIVLPPWYQKPRFEVTLLLTILAGLLFSVCWGLWDLWQKRTKTVSREKAMQSVRQRVKTTTFVAALTGFQLALVTWLR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.