Basic Information | |
---|---|
Taxon OID | 3300021476 Open in IMG/M |
Scaffold ID | Ga0187846_10107332 Open in IMG/M |
Source Dataset Name | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1198 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm → Microbial Communities From Various Locations To Find New Lineages Of Life (Nelli) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Brazil: State of Minas Gerais | |||||||
Coordinates | Lat. (o) | -19.8881 | Long. (o) | -43.6761 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F016891 | Metagenome / Metatranscriptome | 244 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0187846_101073322 | F016891 | N/A | MPNLYFCQPHAKNQGMLRAVLSVPECERVISQQRVTYFGEKFPTLVEGSAGNADFAVIRFSVGETNGHWQPGYYRLDSDLGALNDLLRELAR |
⦗Top⦘ |