NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0194051_1009774

Scaffold Ga0194051_1009774


Overview

Basic Information
Taxon OID3300021470 Open in IMG/M
Scaffold IDGa0194051_1009774 Open in IMG/M
Source Dataset NameAnoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L239-20m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4001
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (77.78%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater → Anoxic Zone Freshwater Microbial Communities From Boreal Shield Lakes In Iisd Experimental Lakes Area, Ontario, Canada

Source Dataset Sampling Location
Location NameCanada: Ontario
CoordinatesLat. (o)49.663Long. (o)-93.723Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012108Metagenome / Metatranscriptome283Y
F057320Metagenome / Metatranscriptome136Y

Sequences

Protein IDFamilyRBSSequence
Ga0194051_10097743F012108GAGMIANGCNLDIFEKVVCALEVALGVNQRRVVTITGGMNTDNRIYCIKAIRLHTGWGLKEAKDWSDYLVGGWKYDKWYPAPSGTKQSMTLKTPEAAEALLRELTTLGCEGFLS
Ga0194051_10097749F057320AGGAMSYVGLYDDEGSKNAFYIVKDKKINRKRVGFKEFTNEAEAKFAHRVQKHLAQFDLAPMVYGDVGFIRRNDGQFTYYGYLTEVARPMPNCNDRDCGDCFNSCCKNGPPIDNVVYGLHQQGLEYIDAHNNNFGYVRREGSWVPVVIDVGVESFGEWDESIYGEFQYENEDDDYDGCNCVQCQKFREEE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.