Basic Information | |
---|---|
Taxon OID | 3300021445 Open in IMG/M |
Scaffold ID | Ga0182009_10826830 Open in IMG/M |
Source Dataset Name | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 508 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Sorghum-Associated Microbial Communities From Plants Grown In Nebraska, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Nebraska | |||||||
Coordinates | Lat. (o) | 41.1613 | Long. (o) | -96.6752 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F017314 | Metagenome / Metatranscriptome | 241 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0182009_108268302 | F017314 | GGAG | MIPARGGASEPSDMQLPGKAGGAVAVRRTLASTICRVLADPTQVTRPRQLRDASTVMRFRPAHQSVINRRHDDRASCPARRSLKPMLEIKPRIHLPATCNGGHESGQNLT |
⦗Top⦘ |