NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0213871_10024798

Scaffold Ga0213871_10024798


Overview

Basic Information
Taxon OID3300021441 Open in IMG/M
Scaffold IDGa0213871_10024798 Open in IMG/M
Source Dataset NameRhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1522
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Plant-Associated Microbial Communities From Velloziaceae Species In Rupestrian Grasslands, The National Park Of Serra Do Cipo, Brazil

Source Dataset Sampling Location
Location NameBrazil: Minas Gerais
CoordinatesLat. (o)-19.2822Long. (o)-43.5936Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015918Metagenome / Metatranscriptome251Y
F034479Metagenome / Metatranscriptome174Y

Sequences

Protein IDFamilyRBSSequence
Ga0213871_100247981F034479GAGLGTQNGGSPSEELVEIQALSVDLRQAVMACLSGCESRRWTVLELVERLKNLGIRASRAGVTAALAELALELELSAWAPWRLLERGTEWILEPKSELLAFLSGVRGLPIKAAKILSEEHKAVLLVVIGYRRKGGVSKTRVGEILGLDASPILDDLMSFGLIYCDPSREFNFWRPASEALLALGLRSSSDIPALKELEEWFDTQKEMRGTAKLDPYFERTNKLAFRRLKREIERRETVLGSPLALAESPP
Ga0213871_100247982F015918N/AQAKPINEVVKDFERSLETLRPSTRRVYVAGARAAIRAASLEIWQSTSLSDLLASIGKSPVEKTIRIAPFLDFLGGREPKQSLSGQDCAALRTRVIQAITKQMRSVKNPSIATRRDMALIAALCAAPARGSPRKWPENCLEISGNEVLLWNALIREPCLALALRFWHAWRERLARPDQRRLYRKSLGWSQSRLLFPGPKGAPLGRAALHNALRRLHVAGEPGSIGPITPENIRVAFLCRDPFKAGIRLTQEGFPKQFRAALFRV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.