NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210389_10000005

Scaffold Ga0210389_10000005


Overview

Basic Information
Taxon OID3300021404 Open in IMG/M
Scaffold IDGa0210389_10000005 Open in IMG/M
Source Dataset NameForest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)290370
Total Scaffold Genes276 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)200 (72.46%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.481016Long. (o)-72.178343Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000579Metagenome / Metatranscriptome1011Y
F014647Metagenome / Metatranscriptome261Y
F092415Metagenome / Metatranscriptome107Y

Sequences

Protein IDFamilyRBSSequence
Ga0210389_10000005189F000579GAGGVAVDSATTISVIDFRRQSMVLQWHSLGGTWTAYDTPPVLVHGIALIRPTGPNICIYGQAGRLRLQVGPNQYALAENSPRISCTRGIASFGFRRRFTVRSSTGGVLFSHSYWTNQGRDFYRWLADKAEDPDWRVSCGRQWSDGVPSATLRPR
Ga0210389_1000000559F014647AGTAGGMSPKLRRNFSGAFQPKSLGDGAWQLSRPAPQEIEVILRNAEHGAAQAFGADPIVDLGIEWHAEKVLLTFMSGERAESVAAAGAIVHEPLERLYESLPLASIDADARRFWRRVFRLVRIPGGRYLLKVLTRSRGR
Ga0210389_1000000584F092415GGAMPDQPNADELDDYLQGDSDVSCQYRRESSPAPPHALDRSVLEAAGSLGPKAPTRSQSLAPLAFAASVLLSLALVLAIVFAPQVKRQDSQPQVVRVRMFKSEPPRAALASPRERNPALWLADINALRRAGRHAEAVVEMRRFHSAYPDYIIPINE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.