NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0213864_10003258

Scaffold Ga0213864_10003258


Overview

Basic Information
Taxon OID3300021379 Open in IMG/M
Scaffold IDGa0213864_10003258 Open in IMG/M
Source Dataset NameCoastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7108
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (62.50%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Coastal Seawater Microbial Communities From Pivers Island, North Carolina, United States

Source Dataset Sampling Location
Location NameUSA: North Carolina
CoordinatesLat. (o)34.7181Long. (o)-76.6707Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012206Metagenome / Metatranscriptome282Y
F031082Metagenome / Metatranscriptome183Y
F032262Metagenome / Metatranscriptome180Y

Sequences

Protein IDFamilyRBSSequence
Ga0213864_1000325813F031082GAGLSLSQNEQLPMTTFDKLLENMRRLGEPDENTRELLFTLAKIIDEERTLQDIVDRDGMVYQTTGDKGQVYIKSRPEYIELQRLRDKKRAYIKAIGISSAEVDDPDFA
Ga0213864_100032582F032262GAGMNDGYDLLALNLAWLGWEVARWQDVVDWSLSALGAVTLVALNLVRLRKALNQQSKVDNQQ
Ga0213864_100032583F012206GGALGPSNNPIMSFDFFEFMAQSKSAASDYVKFQDGDKRSLRLLSKPIGGYELFVEGKPVRWRHDEPRPEHAISDEKPKRFVAFVAFEYDKEVGDNIKVWSISQSTIQDQLKMLFKGIPWTTYELVVSRVGKGLDTHYNVTGIKSPLEENLRAFAFESSKYIDLDKLFTGENPFLQDLPALSVAQDKPQTDDLPF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.