Basic Information | |
---|---|
Taxon OID | 3300021374 Open in IMG/M |
Scaffold ID | Ga0213881_10008571 Open in IMG/M |
Source Dataset Name | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 4182 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock → Plant-Associated Microbial Communities From Velloziaceae Species In Rupestrian Grasslands, The National Park Of Serra Do Cipo, Brazil |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Brazil: Minas Gerais | |||||||
Coordinates | Lat. (o) | -19.28 | Long. (o) | -43.5919 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F006390 | Metagenome / Metatranscriptome | 374 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0213881_100085714 | F006390 | GGA | VVASLITGGVFVLAMVIASVRGAVVLPADARIPVHAGSVERCYLAPKRAGLVIWPAAGALAFGLLGGVAASSLAADWTASVRTVLMPAVVGVL |
⦗Top⦘ |