NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0213858_10083484

Scaffold Ga0213858_10083484


Overview

Basic Information
Taxon OID3300021356 Open in IMG/M
Scaffold IDGa0213858_10083484 Open in IMG/M
Source Dataset NameCoastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1559
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (20.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Coastal Seawater Microbial Communities From Pivers Island, North Carolina, United States

Source Dataset Sampling Location
Location NameUSA: North Carolina
CoordinatesLat. (o)34.7181Long. (o)-76.6707Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006200Metagenome / Metatranscriptome379Y
F015402Metagenome / Metatranscriptome255Y
F016004Metagenome / Metatranscriptome250Y

Sequences

Protein IDFamilyRBSSequence
Ga0213858_100834843F015402N/AMGKTKNLFDFDLELTNEDIQEELMMRNDDEYQYEKWLESKEFVEYVNAELDSTKPLYSESDIMGATRYASQSITIEPSEVGKEVYDMLFSEKIEEYLSLHRNDXLQGLYR
Ga0213858_100834844F006200N/AMNKNDWLETLVKKYSIPKEDKKEKRGILSETQLKNLKNGKN
Ga0213858_100834845F016004AGGAMNKKLLEILQTLKEDFEMLQDGRWDLNYSDGSEIQASLDNIEEAINIVTNEQKXLVRNFG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.