NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0213858_10000242

Scaffold Ga0213858_10000242


Overview

Basic Information
Taxon OID3300021356 Open in IMG/M
Scaffold IDGa0213858_10000242 Open in IMG/M
Source Dataset NameCoastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)26923
Total Scaffold Genes38 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)25 (65.79%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Coastal Seawater Microbial Communities From Pivers Island, North Carolina, United States

Source Dataset Sampling Location
Location NameUSA: North Carolina
CoordinatesLat. (o)34.7181Long. (o)-76.6707Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001582Metagenome / Metatranscriptome668Y
F001942Metagenome / Metatranscriptome613Y
F088799Metagenome / Metatranscriptome109N

Sequences

Protein IDFamilyRBSSequence
Ga0213858_1000024210F088799GAGGMSQYMLETEEDMLAYLDTSYGHGLDAVYIRGGVSTNIKIILNNEYTEQDLGTGVEALKPVAYCRSVDIPNVAYGDLLNASAVTDIHGNILKAAQNYTIVNVQKDRTGFTALMLEEV
Ga0213858_1000024211F001582GAGMPLESAADFNSYVDTTTGHGVTGVFIEIQNNLWDSRTRLIDTWYDIDSGDSYPINLIIDQEYFSIAGGTVSVDGYQPRAIIKATDAPYISQGDKILLHAITTNKGNTLVPETTFLVVTVEPDNTGLIQLVLEEQ
Ga0213858_1000024232F001942N/AMARKSSEEHQGNSRLGALGESLVQTFLLEFCDFVYPTQDKHPADILAEVSNCKYTVQVKARRETKEGKYVFATETSRSMSDVYKNYHCDILAFVFVNQEHKRILFKPNTSSQTYYTFDKKIITPDMEIISLQQTLDALSKVPVLNPVIK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.