NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210301_1241773

Scaffold Ga0210301_1241773


Overview

Basic Information
Taxon OID3300021325 Open in IMG/M
Scaffold IDGa0210301_1241773 Open in IMG/M
Source Dataset NameMetatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1033 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)931
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location
Location NameUSA: Oregon
CoordinatesLat. (o)46.216Long. (o)-123.951Alt. (m)Depth (m)8
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F088160Metagenome / Metatranscriptome109N

Sequences

Protein IDFamilyRBSSequence
Ga0210301_12417732F088160AGGAGGMKVNSSMNATDATGTLWESHSLWGSNNAGGACTMAERSSARRLDESIEASIRSAYFAESGELAVRYGMSVSDVIEHLENAGLGRMPRPERAIDNIKCAVHAAALARGVAQSWADLQTVLAPGFDRACASRLDPMRGIAFARRFWIDLRVSTLGPTTDGRSRSGRSGTTVRRPRGVRAPDLRTFAATRPLRYWLAERLLGSLEVELGRAASAAERLDTVEEVRTLRIPAQMAVGAETRPGFRG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.