NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0206677_10020701

Scaffold Ga0206677_10020701


Overview

Basic Information
Taxon OID3300021085 Open in IMG/M
Scaffold IDGa0206677_10020701 Open in IMG/M
Source Dataset NameAmmonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3976
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)15 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)36.7468Long. (o)-122.0193Alt. (m)Depth (m)30
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005796Metagenome / Metatranscriptome390Y
F062792Metagenome / Metatranscriptome130N
F090424Metagenome / Metatranscriptome108N

Sequences

Protein IDFamilyRBSSequence
Ga0206677_1002070110F062792GAGMINTRMTPQEIDDYKRKWRMGSYFQHHTHTDLRNDCVEWCKENCEKQEWDIKYFTDIYGDTIRFEFESHFNEFGEWYKTRW
Ga0206677_100207016F005796GGAGMLEYAIFVFVVIGCGLTCHALGKQEGIETTIEHLVDNGMLELDEE
Ga0206677_100207018F090424GGAGMIKVTTEDRNLPEFDTFIDECIVALFPDGVNYDINIRYAKFIEDTGLYGGLCTGDQESSTINIATHWKYEDGEIIAYEPHEMAGTLAHELTHAKQFCKNQINMVDHVWRHNGVHIDCEDVDYMEAPWEVEAYEYEKILVDLLWENV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.