NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210382_10091316

Scaffold Ga0210382_10091316


Overview

Basic Information
Taxon OID3300021080 Open in IMG/M
Scaffold IDGa0210382_10091316 Open in IMG/M
Source Dataset NameGroundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1258
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9195Long. (o)-106.9496Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001935Metagenome / Metatranscriptome615Y
F002111Metagenome / Metatranscriptome592Y
F008327Metagenome / Metatranscriptome335Y

Sequences

Protein IDFamilyRBSSequence
Ga0210382_100913162F008327AGGAGGMSMPTGDTPEKVQQFYLYLNGHQETTRPVESWHVDWLSLAWLWGFASIIIVVLLLWVKQYRTTRQRTGIYPVDSFGGWTTEAARPASGFFLLFTVVVVGFAVALIVGHLVWGQKF
Ga0210382_100913163F002111AGAAGMAVAAPPYVSYSSMTEARIPAGLWPTVYSSLQALKGHVQEYPGCQSFDVFVRAEGDGDVLVQCYTTWDTAGQLEVFLERGYTFERLLADIGSGLSAGRSLVMEKVF
Ga0210382_100913165F001935GAGGVYTQRVSSLEFFTYAAFFAVVVVSIASILPGRKPPIRTEPYADDELKAHDGRLPKYFLAGGAFLLLGGVHMVLKNLPWTADWLARAGYAGHLVRDLSNTHVMIV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.