NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210378_10000686

Scaffold Ga0210378_10000686


Overview

Basic Information
Taxon OID3300021073 Open in IMG/M
Scaffold IDGa0210378_10000686 Open in IMG/M
Source Dataset NameGroundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)17516
Total Scaffold Genes19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (68.42%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9197Long. (o)-106.9492Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003951Metagenome / Metatranscriptome460Y
F010980Metagenome / Metatranscriptome296Y
F063668Metagenome / Metatranscriptome129N

Sequences

Protein IDFamilyRBSSequence
Ga0210378_1000068617F003951AGGAGMGPDMQRPAGTATTLQREVCDKCGSQMDLHGSGNGFERWWCANCHQVVGIDRDPEVGSRFQIARGQPWNYSPDVFKN
Ga0210378_100006865F010980AGGGGGVPAYLLINGTEPRWRLHDTMDIPDLEASLTRVRENGAIIYTLASRNEGETFQSLTINGKSLETYVITQENDPDPAKTRSRYEASGF
Ga0210378_100006867F063668GGAGGMTTENDDGNYTGLHAFVFINRVDAGRNIADVIDDIGGPGGAELPNGRVLFASVFVGSYIGFAHVRTGDGDLAALQRLIYHDLGAKGVHCEHAVEGPVYTPMGVNALPKGPKRRSPPFCALVRVRTDDDPAAVMHEIAARFEDSDPFQGASVIFGTADLLIELAGDTLAAVSTPVLNVIRGAPGVVWTETSFAYSEPWRPRP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.