NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0206224_1013971

Scaffold Ga0206224_1013971


Overview

Basic Information
Taxon OID3300021051 Open in IMG/M
Scaffold IDGa0206224_1013971 Open in IMG/M
Source Dataset NameSubsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos A1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)911
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location NameUSA: Colorado
CoordinatesLat. (o)38.96Long. (o)-106.99Alt. (m)Depth (m)50
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025352Metagenome202Y

Sequences

Protein IDFamilyRBSSequence
Ga0206224_10139711F025352N/ANSALDELKKPIEEWARALVDGKPMENLLILYKLLYALGCRIDGIDFEIDRPCVAVIKKAKTLS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.