Basic Information | |
---|---|
Taxon OID | 3300021051 Open in IMG/M |
Scaffold ID | Ga0206224_1000500 Open in IMG/M |
Source Dataset Name | Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos A1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3657 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Colorado | |||||||
Coordinates | Lat. (o) | 38.96 | Long. (o) | -106.99 | Alt. (m) | Depth (m) | 50 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F082441 | Metagenome | 113 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0206224_10005003 | F082441 | AGGAGG | MNTQRISLILSLVVLTWVSTGPSAEVVLGPDLKIPPYYKAGSGSCSPGRGYNMSAEAPSYPSTYPKMNLRIFNGEVIGFLFEVDAKEGWKPWYDQPEGKPTSHDGSHAHYTQTIYIKKGPTAEQCKASKGPYGSEK |
⦗Top⦘ |