| Basic Information | |
|---|---|
| Taxon OID | 3300020812 Open in IMG/M |
| Scaffold ID | Ga0214071_1365574 Open in IMG/M |
| Source Dataset Name | Anaerobic digester digestate microbial community, University of Toronto, Ontario, Canada - DG074 megahit |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Toronto |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1983 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → Candidatus Velamenicoccus → Candidatus Velamenicoccus archaeovorus | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester Digestate → Metagenomes From Anaerobic Digester Of Solid Waste |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | University of Toronto, Toronto, Ontario, Canada | |||||||
| Coordinates | Lat. (o) | 43.5479 | Long. (o) | -79.6609 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F069433 | Metagenome / Metatranscriptome | 124 | N |
| F072819 | Metagenome | 121 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0214071_13655742 | F072819 | N/A | MGMFQDQTKAQEVSFRIARLEGENAVSELVNWCRNNLDELTVQCFTHKRFMSVQALVDVLCEIYRDLGVEGDKGNVSAFVLFLAGKHRDKIYASHVVELNDTHRQILRDKLGLDIEEIEPGLSKLDWRTDAGI |
| Ga0214071_13655743 | F069433 | N/A | VRRGLTQASFTDPTITALVTEIRKVHVDQLRTELAACKSGRGESGYCPQDSSGCMDFTDPTITALSTEVRGVHFREMTQKVQALMTGCICETEQCQYCADCGYHYTTCSHAGVACDDHKYSECHHSINHYWICASINLPSATEHPYKSANPPVAWDGYVPWDWCVYTPPGLNWGTCEYSGGHNHSAWNCKCNPYSW |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |