NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214169_101069

Scaffold Ga0214169_101069


Overview

Basic Information
Taxon OID3300020677 Open in IMG/M
Scaffold IDGa0214169_101069 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Trout Bog Lake, WI - 13JUN2007 epilimnion
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1810
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (20.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameTrout Bog, Vilas County, Wisconsin, USA
CoordinatesLat. (o)46.041Long. (o)-89.686Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019949Metagenome / Metatranscriptome226N
F028417Metagenome / Metatranscriptome191N
F039010Metagenome / Metatranscriptome164N

Sequences

Protein IDFamilyRBSSequence
Ga0214169_1010692F028417GAGMATNESSDNKNQLITLMLQTIENFVPLETRPAPEGMAIYLYELKKEILRQNPKFKFINSYNDYIFRILTLLDYLDVSKEYDTESHGKTVHMICRETRDIKRIDPLWKINPTSVIEFINSTLSASARK
Ga0214169_1010693F019949N/AMYQEKNRYSKRTLRFTDDLLYNNSTAEDEANKEILREELEKSIDKSVVFQLAFNTFKIEMQEIKLLRLVEKLLHTVDKMHNLSPLQKARKFSKIYELKQKITQINLNWKISDSFYLKKYKILTLIDRIDVKEEYNSVANEEIYQQLINEVETAKGTNSTWQLDKELIIIKKIE
Ga0214169_1010694F039010N/AMEENEDLDASGIDSHRSDDSNEVRCRFHDFMSHEIETLDQILVEMISVAENISENTIISQLKRCFEYIDNMMIYVNQFINQAQSVKMKHFIRFYSLYDGIRHSMMRTLTIINNLRKRNLFQMVPLVKDLTLDLDEIKVLVSRTTLEQVKEVLEGYRIKRSYIRRKIENFI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.