NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210407_10005891

Scaffold Ga0210407_10005891


Overview

Basic Information
Taxon OID3300020579 Open in IMG/M
Scaffold IDGa0210407_10005891 Open in IMG/M
Source Dataset NameForest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9437
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)14 (93.33%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.481016Long. (o)-72.178343Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000828Metagenome / Metatranscriptome872Y
F004589Metagenome / Metatranscriptome432Y
F005961Metagenome / Metatranscriptome385Y
F055955Metagenome / Metatranscriptome138Y

Sequences

Protein IDFamilyRBSSequence
Ga0210407_1000589111F000828GGAGMSIFDEQYRVVAIEDDRLVIRGTLSGDVLTIINPEPETPLTKEDYPPGKLIALSDPSQTPLN
Ga0210407_1000589114F055955N/AMKMTIRVNPPRVRVTIIAILLTTLLPLAAIPRCSAQNQIRVVEILADKDSRYKIGRQTSPTLTFKAGEEVQFRITARKAKTRNRNGSIHGFALIRKKDGAKFADWDLELKPGIQEFILKVPSEPGEYEIVCTVICSEGHEDMHMKVIVVA
Ga0210407_100058917F004589GAGGMKKQYLHLSAYSCDKCAGPVISGSIGVRENDISKETDIRQVGAICLSCAHRQSQATEPGVTRSFPPMLWEFGKVMGARAAAVT
Ga0210407_100058918F005961AGGAMKILLFVGLLLVALGVASLVVPIPHTETQGIKIGDAKLGVETSHSEHVSPIISVVLIAGGIALSIAGARTRAS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.