NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208358_1010378

Scaffold Ga0208358_1010378


Overview

Basic Information
Taxon OID3300020555 Open in IMG/M
Scaffold IDGa0208358_1010378 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 10AUG2009 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1798
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (25.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004232Metagenome / Metatranscriptome447Y
F016961Metagenome / Metatranscriptome243N
F057903Metagenome / Metatranscriptome135N

Sequences

Protein IDFamilyRBSSequence
Ga0208358_10103782F057903N/AMADGKRLESAISTTLLKMKYKNSGNSSVEVELLSDDVEIRIGETKWSGVAYMREGKAKIYVRTKAEFKAKFVLIDAKP
Ga0208358_10103786F004232N/AMNKTIVACDPGVNGGFAIHTKDGILLFPMPESLPDMAQLLSGFKLADSHLWIEKVPKFVSKLTPAASVATLHENYGIIQGLAYSQGYALHRVEPKIWQEPLGLGGRKACATGPEWKRKLKSKAQELYPHLDVSLKNCDALLILHYAQGGGR
Ga0208358_10103787F016961GGAMNTVITIVCMAVLMPLCVIAGIYVGHSLTIKSQNTKTNEQNNRSL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.