| Basic Information | |
|---|---|
| Taxon OID | 3300020551 Open in IMG/M |
| Scaffold ID | Ga0208360_1010953 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1287 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Mendota, Madison, Wisconsin, USA | |||||||
| Coordinates | Lat. (o) | 43.098333 | Long. (o) | -89.405278 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003786 | Metagenome / Metatranscriptome | 468 | N |
| F019647 | Metagenome / Metatranscriptome | 228 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0208360_10109531 | F019647 | AGGA | MKIVKGVVKYGAGAPREGQYGPSINILVTLQDQSQVRVYGKPGDVIERYKSGQNIQLIDDKGKYKVVEDEPQTPAAQIEQSEKPDLAALVFEMSAIYSQAYIDIYNKISEA |
| Ga0208360_10109533 | F003786 | N/A | LNVISSVFPMYGIDGDLAFYANIAKEIVKTFGQIAANEIEIAFRLFSAESLELDDDIKFYGKANMHTIGKILNGYMTYRRKIIASHDNEVAALRHQVQMEERGKAEREKLYAEFPTMIKEFTGKTFEDVPLYWYDMCLKFDMITYEEGEKRALWDEAQAIALKEPPESLDLLTIRSHAKKIEQGNMKRAVVIAQKLAVWRKVIKK |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |