NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208360_1005453

Scaffold Ga0208360_1005453


Overview

Basic Information
Taxon OID3300020551 Open in IMG/M
Scaffold IDGa0208360_1005453 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1974
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (28.57%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001272Metagenome / Metatranscriptome733Y
F002621Metagenome / Metatranscriptome542Y
F083941Metagenome / Metatranscriptome112N

Sequences

Protein IDFamilyRBSSequence
Ga0208360_10054532F002621GAGMSSTAKHPSLSRMIWLLVLPIFPACQQTKVVLVPSGDPVMLAKPTKASVYGFDKDQKLVGPSTVTLPAGWYALPKTK
Ga0208360_10054534F083941GAGMPPVDTHDLEVRIVRLETTIGDKDSGLVSDIHGIKACVEGLKQFQFKLFGGLAVIVVLAQMFVRIVLK
Ga0208360_10054535F001272N/AMIQIELTQEQANQLLQLIDIAIKAGGYQNAKVGVPLADIIIQAAQTPKPE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.