NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208594_1031792

Scaffold Ga0208594_1031792


Overview

Basic Information
Taxon OID3300020509 Open in IMG/M
Scaffold IDGa0208594_1031792 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 14SEP2010 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)584
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008016Metagenome / Metatranscriptome340Y

Sequences

Protein IDFamilyRBSSequence
Ga0208594_10317921F008016N/AEPHLKSPFHRGGELTWDEIHQSIYMMPNILHLILVFLCFSYYLAPNVFPLILMVLNIMMFFYKNFKKVKKSYDTLYQIWSGKPSVHKLSKKEKIRNDISYVTGKDINPFNPDMPLSDQLLHKKSEKSNVPMIKKIENVPRPLNCERPELKNSENLSQNLSLRCTAEPKMKNEKSHWMVTKIHLRSVAPSSNAEH

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.