NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208084_1008488

Scaffold Ga0208084_1008488


Overview

Basic Information
Taxon OID3300020499 Open in IMG/M
Scaffold IDGa0208084_1008488 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 14SEP2009 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1255
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016958Metagenome / Metatranscriptome243Y
F037190Metagenome / Metatranscriptome168Y
F040535Metagenome / Metatranscriptome161Y

Sequences

Protein IDFamilyRBSSequence
Ga0208084_10084882F016958N/AMSGNTSTMELPTKENVYYFIDLYKKSLKKNQRVKITCDILGIDGYLQGTAPLR
Ga0208084_10084884F037190AGGAMDRYLLIELGSEGIAIETAQADFYASWLGIALVILSVVGYRIVKRIKKGY
Ga0208084_10084885F040535AGGMLTLNYTIEKDGIVLSEINKLMLSERQINDLMDTLVANGYTVDSMSVSEFVTL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.