NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208050_1001141

Scaffold Ga0208050_1001141


Overview

Basic Information
Taxon OID3300020498 Open in IMG/M
Scaffold IDGa0208050_1001141 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3807
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (92.31%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.099444Long. (o)-89.404444Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002071Metagenome / Metatranscriptome596Y
F003663Metagenome / Metatranscriptome474Y
F080027Metagenome / Metatranscriptome115N
F101047Metagenome / Metatranscriptome102N

Sequences

Protein IDFamilyRBSSequence
Ga0208050_100114111F101047AGGAMGRMKELYTQILECETCNGQGWQFFGNETDYDVEACECNPLGFFQENK
Ga0208050_100114113F080027N/ANSRHFSGEIVSAEHRPEIYYGEKTEAYLIEVRAGGLRNKFATIAVKVGE
Ga0208050_10011412F002071AGGAMATTLEVGQTYTTTTSGITGIVKAIDNHPSGVNRVLLDVEGQERWTSVSAK
Ga0208050_10011414F003663AGGTGGMLSTAIEILEATRNSIFDEDIMGMAGELHTRRNELPDEVYAKYLFMYSSALSSKVADLVTKILLTEQEMSDLIATIDEMDNLSETILEENE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.