NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211676_10013714

Scaffold Ga0211676_10013714


Overview

Basic Information
Taxon OID3300020463 Open in IMG/M
Scaffold IDGa0211676_10013714 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6766
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (6.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameTARA_094
CoordinatesLat. (o)-32.7806Long. (o)-87.0917Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F045129Metagenome / Metatranscriptome153Y
F049660Metagenome / Metatranscriptome146Y
F095485Metagenome / Metatranscriptome105Y

Sequences

Protein IDFamilyRBSSequence
Ga0211676_100137146F049660N/AMKRYSGKPRGRVNQGGATHDKDREKLKQFGKNYNSIDFEMSDRITESNYKDKANPIGTLIVGNQRIDLTWSECNKVFSTLLDAQNTHKRKIQLGMFN
Ga0211676_100137147F095485N/AMNAEELFKELGLGDKEMNSAREWVNYKHFSKTIPDILTLSEYIDTVYKHAVTMDAKPHQWFSERYMTERYLESDTDIDSDYISNLEKRVVKILDKNNTLELHIEKFLELILTVVRKSKLALPKETLIVLNEIYKGK
Ga0211676_100137148F045129N/AMSIHYIDEPYRQKVIDILSTDEPLEKQTLNLKLYLIGEPYFKHFTSEPSWLTKEIIRDFN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.