NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211473_10015887

Scaffold Ga0211473_10015887


Overview

Basic Information
Taxon OID3300020451 Open in IMG/M
Scaffold IDGa0211473_10015887 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3657
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (53.85%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameTARA_150
CoordinatesLat. (o)35.7956Long. (o)-37.0998Alt. (m)Depth (m)40
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017493Metagenome / Metatranscriptome240Y
F039683Metagenome / Metatranscriptome163N
F099444Metagenome / Metatranscriptome103N

Sequences

Protein IDFamilyRBSSequence
Ga0211473_100158875F017493N/AMALCDECSCYDDNWVDGEDITEEDLEKDPLYEPHRYYYWHGDIQEDYQMPKGYECLCERCFGDLLGDGKIIEKYEWRTNKLNPKWDSDTMGWFVPV
Ga0211473_100158877F099444GGAGMSYTKNEAALLDFQHDVSKLFYYVGEEDDQIPFSSLRKFEKYCIAFINAIEVEEDD
Ga0211473_100158878F039683GGAGGMLYDEIIKCYEGETELHANTSFEFGLMNDTYWCLFRDHDMLEYALK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.