NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211603_10004609

Scaffold Ga0211603_10004609


Overview

Basic Information
Taxon OID3300020427 Open in IMG/M
Scaffold IDGa0211603_10004609 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B000000460 (ERX555922-ERR598960)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5928
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (60.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameTARA_065
CoordinatesLat. (o)-35.2792Long. (o)26.382Alt. (m)Depth (m)850
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000747Metagenome / Metatranscriptome908Y
F000929Metagenome / Metatranscriptome830Y
F017843Metagenome / Metatranscriptome238N

Sequences

Protein IDFamilyRBSSequence
Ga0211603_100046093F000747N/AMKKLLVLLLLLPLAASARMFPTEFPIKAVCWNDISEALEYHQEMLGEYPIGKGWIDSKEGPSFGAIMYNPMKPSWTFLSFHKNGEAIIVCAITGGTVWEIIHPGDEAEKLQL
Ga0211603_100046094F000929GAGMSNGTQLNKSLSVGHIVATVGLIIGGFTFIYDLRESVAIQSFQLESVENRLERIVQRTDDQFGEIMDHLVRLEEKLDSIVLNPVQQKGEL
Ga0211603_100046095F017843AGAAGGMKKLLFALLVLPMSLFAADFDSIGVDISGHNDQGTNFGISDSGSLSLALAGEGYTFTFDQDGNDMAVSAYGVELSRSDSKKVGVGYGAGIGILDGGVHYNWMSSGDHVVGGGTTLTVGGFDLATSADWNLTASNITGKVGTSMDLWGAKASALSKWDIDDFSYDGLELDAGYAIPVAAGIHITPSVGVDFDSDWGRGDATASVSISLSFGSNGIPAS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.