NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211653_10002868

Scaffold Ga0211653_10002868


Overview

Basic Information
Taxon OID3300020421 Open in IMG/M
Scaffold IDGa0211653_10002868 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9219
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (54.55%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location
Location NameTARA_102
CoordinatesLat. (o)-5.2476Long. (o)-85.3343Alt. (m)Depth (m)40
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001215Metagenome746Y
F025263Metagenome / Metatranscriptome202Y

Sequences

Protein IDFamilyRBSSequence
Ga0211653_100028683F025263GAGGMAINPNQISVAKIYPGNYANVLRYWHEEKTMQFENANGVSSSYTNQPVGGPVGVIFRPGWVAQQAIGYVDLSYQALGSVNQLEYYTQAYGSGVNSSPNGNSNVAFSNAAVIIPSPDFHKDVRQDIADGIQVPSGVYCYRASLRITGGDVVSSGIPGSEAAPTLSLAPAVGEGYPNDNTVVSGGFAVSAIGANRCIPNGSVASTNIIDSSLLEATTAETQWKLFATTNASPVVQGSGVYDPRAGNNFLSGDEKALAICEVCWILPDSPPERQDVALQPDGVTESSVYTSTQPR
Ga0211653_100028689F001215N/AMVDRPFLRGARFTEGSSVINPAVPDFSTLTQLVRVGDIPSEDAALVEDIWCVSNEAYPDDAGMYTAEFGLYVYAPNQSAPATSFPMMIGKYEIGLSGGKDGLPQPVILPSTNAPTPQTGNTNLLRPIMIGKMEGLYLEKGYILCVGYLGAGGSPTTFTPSGSLSASGVTWFAQGGFY
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.