| Basic Information | |
|---|---|
| Taxon OID | 3300020381 Open in IMG/M |
| Scaffold ID | Ga0211476_10158068 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291769-ERR318620) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | CEA Genoscope |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 817 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | TARA_030 | |||||||
| Coordinates | Lat. (o) | 33.93 | Long. (o) | 32.7322 | Alt. (m) | Depth (m) | 70 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F031561 | Metagenome | 182 | Y |
| F037816 | Metagenome | 167 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0211476_101580681 | F031561 | N/A | QRVEEGSINLRLPTSSDRDRTVTYSNLNVDLEPDARQINYDIVFNKKTTESSNLSANLTHVQNGDHSKSSKNQNFISLFYKKTF |
| Ga0211476_101580682 | F037816 | N/A | LSSNKLSIFISFLLFSCSSHLIQAEEIKPENLKCGSNSGVTFFEKNGLFTPNDKDFNYKLGLIDKNLTKRDFNLIYISKPQNSGGYTLNLQKIIKKKDKYQIYFKENKPPPGSASIMAITATYCLLKTKNLEKVEVFNK |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |