NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211600_1039468

Scaffold Ga0211600_1039468


Overview

Basic Information
Taxon OID3300020348 Open in IMG/M
Scaffold IDGa0211600_1039468 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100000676 (ERX556089-ERR599161)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1180
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location
Location NameTARA_124
CoordinatesLat. (o)-9.067Long. (o)-140.6346Alt. (m)Depth (m)120
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004418Metagenome / Metatranscriptome439Y

Sequences

Protein IDFamilyRBSSequence
Ga0211600_10394682F004418GAGGMLQVWAKWLVNDWKYNRFRLICETLGSLAFILIYLLMAWYGDDVCITTIFIIQLVGSTLHIINAYMRSSVNLIMLNTIVILIALFGLGKMHLWGEGEFILW

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.