NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211504_1000732

Scaffold Ga0211504_1000732


Overview

Basic Information
Taxon OID3300020347 Open in IMG/M
Scaffold IDGa0211504_1000732 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)16041
Total Scaffold Genes30 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (23.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameTARA_067
CoordinatesLat. (o)32.1Long. (o)17.7Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002033Metagenome / Metatranscriptome601Y
F080527Metagenome / Metatranscriptome115Y
F089432Metagenome / Metatranscriptome109N

Sequences

Protein IDFamilyRBSSequence
Ga0211504_100073213F002033N/AMNKLDTFLTKHGTKIVVAMLVLTYFKSCGVDSELTKIKKDQRALVAEVDSLQAQLEQNIITEDKMIKLIKEVPAWKTLRIEEISDKERISINALEEKED
Ga0211504_100073222F080527AGAAGMKKPLVVYYLHYYDEDHRERAFNKFQDFTICVMAENNTEAIEKAKLISGNDNIKIMGISTGKEEWVNEKAPMGTGEEIMPLGGWNQEWKNK
Ga0211504_10007324F089432GAGGMDGKQSESKKWLAENEWPDLPVNSDAFAHYTYLSELMDQFAKEYHEKQLVKYASVQKSKFKKYL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.