NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0180732_1008996

Scaffold Ga0180732_1008996


Overview

Basic Information
Taxon OID3300020171 Open in IMG/M
Scaffold IDGa0180732_1008996 Open in IMG/M
Source Dataset NameGroundwater microbial communities from the Olkiluoto Island deep subsurface site, Finland - KR11_0.1 MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4121
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (25.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Groundwater Microbial Communities From Three Deep Subsurface Sites In Europe

Source Dataset Sampling Location
Location NameFinland: Olkiluoto Island
CoordinatesLat. (o)61.2413Long. (o)21.4947Alt. (m)Depth (m)420
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021096Metagenome / Metatranscriptome220N
F060705Metagenome / Metatranscriptome132N
F064517Metagenome / Metatranscriptome128N

Sequences

Protein IDFamilyRBSSequence
Ga0180732_10089963F064517AGCAGMARTTTENIYYGRSQQITADGCFAIAFFRPSTSNPVNVSGIPLEAGQTLSIKQNVGDEDWSAYEIVFGTGTATNELYVTKIMPLTRG
Ga0180732_10089966F060705N/AMAISSLNFIISQFESEKYRYFAIYDEDGDRVYFQNDLIDVETSINKLRNFFKDNQGYYTIRVFSKKLSDKNNLIARDNSTIAKYNVEVSMPVLPQGVNGLTGMGGNPMLPPDDPRSNAPNMFQLLGQMSQVEQQMKLMEKDHAHYREMKELQDRIAKMEEEGSKAKGMGAIVDRLGEQFSDPNVLLGLISGVSQLFKKESVVPMHGVSRDDIMPMNGIDEQVINNISTRREKMVGAVNFLMQHDANFPENISRLADLAKNKPAIYSMAVSYLNNL
Ga0180732_10089967F021096GGAGGVAAVVSPIINYFLSNNLCKDYTAIEGEMSTLVTLNFPNTGDYQRSYYFASQTMLDGQNCTITAIEVVPSTELAQLPTGQTNVDSSILPNGVLYMSNLKRQIIAQLPLYGLQRTANNGKPTFTYFNDQVWQNCYVEFTSTGFATPTTPLTFRVYYVNKQKN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.