NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0206128_1020314

Scaffold Ga0206128_1020314


Overview

Basic Information
Taxon OID3300020166 Open in IMG/M
Scaffold IDGa0206128_1020314 Open in IMG/M
Source Dataset NamePelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3791
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location NameAtlantic Ocean: North Sea, Helgoland
CoordinatesLat. (o)54.1841Long. (o)7.9Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005132Metagenome / Metatranscriptome411Y
F016593Metagenome / Metatranscriptome246Y
F052949Metagenome / Metatranscriptome142N

Sequences

Protein IDFamilyRBSSequence
Ga0206128_10203143F005132N/AMVDVIFIDDNYLYQNFPLPKRMDRGALLALIQLEQYTSIQDLLGTCLYEDIEAKVLAETLNVAEQGLFKLVKYTLAMYSAKAAISILRTATATTKAEEQKQDQYILDTISTTVDSKLSYINKRITNYILDNAAIKAIATADGCDNDLFDEEDTYQGDVFYPQDGIIYKSCEDGGVSYNP
Ga0206128_10203145F016593N/AMKRLKTGVVNTLSFVKLSSFTVNSFDVTLDKVVGTGSLTITNLTDLNNLDSCKDFIQINIDLLSNDIEGGEYVFTITNSGDSYKYLTEVQDYTVTQTGTGIYGSTVRFTDL
Ga0206128_10203146F052949N/AMKGNIYISVPASDITNELPAAITRYDWTENTYNEEGEVESTTNHHPTWEQFGSRNSGLFGSPVSIADVVVYEMEASWLDSEVSALIALGDGQSAPNYTVYTNAEVRTFIAENTPAEL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.